Rhombotin-1

UniProt : P25800, UniProt ID: RBTN1_HUMAN,

Rhombotin-1

Homo sapiens

MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN
QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Rhombotin-1 contains a PF00412 domain.

Rhombotin-1 contains a PF00412 domain.

Rhombotin-1 is proteolytically cut by caspase () cleavage. DKED-GVPM.