Rhombotin-1
|
UniProt : P25800, UniProt ID: RBTN1_HUMAN, Rhombotin-1 Homo sapiens MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Rhombotin-1 contains a PF00412 domain.
Rhombotin-1 contains a PF00412 domain.
Rhombotin-1 is proteolytically cut by caspase () cleavage. DKED-GVPM.