Protein spaetzle

UniProt : P48607, UniProt ID: SPZ_DROME,

Protein spaetzle

Drosophila melanogaster

MMTPMWISLFKVLLLLFAFFATYEAKEYERIIKELFTITNDEGVVLFNTSADSAPFMPIP
TQHDDPTQKQKQNQNQSPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSL
QRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDESQHL
RNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPK
KGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASI
KSDGELDVVQNSFKIPSCCKCALKTG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein spaetzle is proteolytically cut by Easter peptidase (S01.201) cleavage. VSSR-VGGS.