Kappa-casein

UniProt : P04468, UniProt ID: CASK_RAT,

Kappa-casein

Rattus norvegicus

MMRNFIVVMNILALTLPFLAAEVQNPDSNCREKNEVVYDVQRVLYTPVSSVLNRNHYEPI
YYHYRTSVPVSPYAYFPVGLKLLLLRSPAQILKWQPMPNFPQPVGVPHPIPNPSFLAIPT
NEKHDNTAIPASNTIAPIVSTPVSTTESVVNTVANTEASTVPISTPETATVPVTSPAA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kappa-casein contains a PF00997 domain.

Kappa-casein is proteolytically cut by chymosin (A01.006) cleavage. NPSF-LAIP.