Protein gurken

UniProt : P42287, UniProt ID: GRK_DROME,

Protein gurken

Drosophila melanogaster

MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQ
ETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIIL
GSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQM
LPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQ
RKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein gurken contains a PF00008 domain.

Protein gurken is proteolytically cut by GlpG peptidase (S54.016) cleavage. RMAH-IVFS.

Protein gurken is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

Protein gurken is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

Protein gurken is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

Protein gurken is proteolytically cut by GlpG peptidase (S54.016) cleavage. RMAH-IVFS.

Protein gurken is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

Protein gurken is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

Protein gurken is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

Protein gurken is proteolytically cut by Rhomboid-2 (S54.010) cleavage..