Twist-related protein 1

UniProt : P26687, UniProt ID: TWST1_MOUSE,

Twist-related protein 1

Mus musculus

MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGI
GGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVR
ERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCS
YVAHERLSYAFSVWRMEGAWSMSASH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Twist-related protein 1 contains a PF00010 domain.

Twist-related protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DELD-SKMA.