Protein phosphatase 1, regulatory (Inhibitor) subunit 11

UniProt : A2BEK1, O60927, UniProt ID: A2BEK1_HUMAN, PP1RB_HUMAN,

Protein phosphatase 1, regulatory (Inhibitor) subunit 11

Homo sapiens

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKC
CCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPP
PGPMQH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein phosphatase 1, regulatory (Inhibitor) subunit 11 contains a PF07491 domain.

Protein phosphatase 1, regulatory (Inhibitor) subunit 11 is proteolytically cut by caspase-3 (C14.003) cleavage. DTVD-NEHM.