Bacteriocin leucocin-A

UniProt : P34034, UniProt ID: LCCA_LEUGE,

Bacteriocin leucocin-A

Leuconostoc gelidum

MMNMKPTESYEQLDNSALEQVVGGKYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGF
W

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Bacteriocin leucocin-A contains a PF01721 domain.

Bacteriocin leucocin-A is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. VVGG-KYYG.