Synapsin-2

UniProt : Q63537, UniProt ID: SYN2_RAT,

Synapsin-2

Rattus norvegicus

MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQPPPAPGPGTATASAATSAASPGPERRP
PPAQAPAPQPAPQPAPTPSVGSSFFSSLSQAVKQTAASAGLVDAPAPSAASRKAKVLLVV
DEPHTDWAKCFRGKKILGDYDIKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFR
PDFVLIRQHAFGMAENEDFRHLVIGMQYAGLPSINSLESIYNFCDKPWVFAQMVAIFKTL
GGEKFPLIEQTYYPNHREMLTLPTFPVVVKIGHAHSGMGKVKVENHYDFQDIASVVALTQ
TYATAEPFIDAKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMSDRYKLWVDA
CSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITDLVISKMNQLLS
RTPALSPQRPLTTQQPQSGTLKEPDSSKTPPQRPAPQGGPGQPQGMQPPGKVLPPRRLPS
GPSLPPSSSSSSSSSSSSSAPQRPGGPTSTQVNASSSSNSLAEPQAPQAAPPQKPQPHPQ
LNKSQSLTNAFSFSESSFFRSSANEDEAKAETIRSLRKSFASLFSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Synapsin-2 contains a PF02078 domain.

Synapsin-2 contains a PF02750 domain.

Synapsin-2 is proteolytically cut by caspase-3 (C14.003) cleavage..

Synapsin-2 is proteolytically cut by calpain-2 (C02.002) cleavage..