Neuropeptide Y

UniProt : P07808, UniProt ID: NPY_RAT,

Neuropeptide Y

Rattus norvegicus

MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neuropeptide Y contains a PF00159 domain.

Neuropeptide Y is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. YGKR-SSPE.

Neuropeptide Y is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YGKR-SSPE.