Glutamyl-endopeptidase

UniProt : Q9EXR9, UniProt ID: Q9EXR9_BACIN,

Glutamyl-endopeptidase

Bacillus intermedius

MMKKVKMLLPSLLVFGALSVPSFAHATSDSVLTSDYDMVTSDGKVISSSDFHNDTKSPSS
FDKVDDLSSTSGEKVKPLSKYLKDFQTKVVIGDDGRTKVANTRVAPYNSIAYITFGGSSC
TGTLIAPNKILTNGHCVYNTASRSYSAKGSVYPGMNDSTAVNGSANMTEFYVPSGYINTG
ASQYDFAVIKTDTNIGNTVGYRSIRQVTNLTGTTIKISGYPGDKMRSTGKVSQWEMSGSV
TREDTNLAYYTIDTFSGNSGSAMLDQNQQIVGVHNAGYSNGTINGGPKATAAFVEFINYA
KAQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glutamyl-endopeptidase contains a PF00089 domain.

Glutamyl-endopeptidase is proteolytically cut by trypsin () cleavage. FQTK-VVIG.

Glutamyl-endopeptidase is proteolytically cut by subtilisin () cleavage. FQTK-VVIG.