cDNA FLJ90528 fis, clone NT2RP4001877, highly similar to RNA-binding protein 8A (RNA binding motif protein 8A, isoform CRA_b)

UniProt : B3KQI9, Q9Y5S9, UniProt ID: B3KQI9_HUMAN, RBM8A_HUMAN,

cDNA FLJ90528 fis, clone NT2RP4001877, highly similar to RNA-binding protein 8A (RNA binding motif protein 8A, isoform CRA_b)

Homo sapiens

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ90528 fis, clone NT2RP4001877, highly similar to RNA-binding protein 8A (RNA binding motif protein 8A, isoform CRA_b) contains a PF00076 domain.

cDNA FLJ90528 fis, clone NT2RP4001877, highly similar to RNA-binding protein 8A (RNA binding motif protein 8A, isoform CRA_b) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. MRED-YDSV.