Nonstructural polyprotein

UniProt : O36184, UniProt ID: O36184_9VIRU,

Nonstructural polyprotein

Plautia stali intestine virus

MMFSLNSLNSRTDFTDDDLMLLDLEKPVTLFDKEIFRQTLADMDGKDSYSYYSIERMIFE
DLHNPYLGNVNHVRKRNFIQPIKRWYDMYNPVCVSFDRKVQGYGVNWPHFLFLHRHDETE
SQYNTHHLFRSDVDLVVEYERNCVWFDLSARDVETYSFILGLPENIQYNCLDQILDDRFT
SEDLFHLIENLQFARKLPLVVFDGKWRFQQPHLSLFKFIDNYISLTDLTKFRLVSHMERV
SSKFLFPQRSTVSLCSDGTILVEDPYTYVQHPQTSYNVVPPQLNLQSSGNILEDFIRKYE
TELRFMCGQKKLQGINITHKIDKDDLQAVINSVMATVSEQWSQVKGKVLKLFLILVKFLT
GLLLVSLGLKILKDLSALSVIKTFLFLLFGMCSLDKFFIYFEESLVCQDGLKDESQFLSL
FLLDKLFLNGCPVSMKNAKDFVWFVSQAPRFSQGITHIVSYVKDLYVHCEHFFRVKILGL
PSLSYESPVCTWIEAIQDIYEKYKKNILVLDARLLDKLFNLYKEGNRFLCTPAFKNQSQI
IVKYINLTYNLIDKVPISQRGGYKNSLRPPPVSLLLLGGTGRGKTTVTFPLTTEVATRIY
LEEHEGDITDEDIASSIYARNSEQEYWDGYTGQLITVFDDFMQRVDSASNPNLEIFEMIR
ASNIFPYPLHMANLEDKNNTWFRSSVILASSNLTAENLQSKVHSLNYPVALLRRFDLVVE
VEIAPGCTKPRAGQPFSKDIYKFTKVEYILDESDRVSIVRSEISYDEIVKLMCLKYKDNM
TTCQSVSANITEMIGNVRKQVMKAKEESHLTIEPSENNLLATQGWLSWFVDSYEEENDLG
YDNFFDEVVTPDQYIEKFETAVIDITPDPKPDEISADKERTTMIWRTHFSQICEEYPIVP
YLATFGLVVTALGVGYTIYRCFFNGETTPLAKSEIVLPKFPESQEKEGVISRCKIESQEK
IGSVSRVRVESQEKLGAIPHVKIEQSVFNATEDSVNMQCNGNVENLALQNYYSKVNEMLT
VEGCSDQNAAEILSKVVCRNYYALFVCRPDGRESRLGHILFLKDKIGYMPQHFLFSLRKE
MEESPDSFISLRSIFLRVNMYEIYICDFLNYNIFVPENDGGRLVDSCLVDVETVTKHPDI
LTTYVSQTEVKSLLRSDVCLPFIHVPESNKYKPYATIAYGTGQSQLVKGGEISSISTYDA
TFYFRQSWKYKLQTASGTCGAPVILIGAKQGPGRICGMHVMGDSQGNGYAVAITRELLCK
WINDLNPTIQSSEMEKKMIQNGVFDTLPFPGKFISLGDSPISISAASKTQLRKSVLYGEI
APVLTKPTWLTPGTLNGEVWDPRNYRLSLFGRPRTLVKMNLLNSIKDRLVQRIYVMEYGS
NYKYESRYPFETACEGIDSDPTFNSIKRKTSAGYPLCSKVKNGKQEIFGSDGPFNFKTKL
ALDLRKDVEHIESLAMDGISSVHVFIDTLKDERKAIEKAHKTRLFSASPLPYLILCRMYL
QGGVSRLIRGKIVNNIAVGTNPYSDDWTRVAHHLLRNRHFVAGDFASYDSSQEKEILRAA
CEVIVELCEDLSLPQSERDKHRRVRWVLLESLLNSVHYSYGKLYYWSKSLPSGHFLTSII
NSIFVNIAMCYAFVESQEKGNRSEENIRVFFNDFSIVTYGDDHVIGVPEKYVEDFNQLTL
PKLLKTLGLDYTMEDKDRICDIKSRKLEEVTFIKRSFRYVKELDRWLAPLDLNSILDCMN
WQRSGEDEGLNAQANVSFALKELSLHPEDVWDQWFPLILRACNKHGVEVEFLSRHAAFQA
VRETDFFEEES

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nonstructural polyprotein contains a PF00680 domain.

Nonstructural polyprotein contains a PF00910 domain.

Nonstructural polyprotein is proteolytically cut by C3 peptidase () cleavage. LATQ-GWLS.

Nonstructural polyprotein is proteolytically cut by C3 peptidase () cleavage. KMIQ-NGVF.