Cell adhesion molecule with homology to L1CAM

UniProt : A2RRK1, UniProt ID: A2RRK1_MOUSE,

Cell adhesion molecule with homology to L1CAM

Mus musculus

MMELPLCGRGLILSLIFLLLKLSAAEIPLSVQQVPTIVKQSYVQVAFPFDEYFQIECEAK
GNPEPIFSWTKDDKPFDLSDPRIIAANNSGTFKIPNEGHISHFQGKYRCFASNRLGTAVS
EEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLPPLHIYWMNIELEHIEQDERV
YMSQRGDLYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSSNSIKQRKPKLLLP
PAQMGSLSAKTVLKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENI
SYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGILLCEAEGEPQP
TIKWRLNGLPIEKHPFPGDFMFPREISFTNLLPNHTGVYQCEASNIHGTILANANIDVID
VIPLIKTKNEENYATVVGYSAFLHCEYFASPKATVVWEVADETHPLEGDRYHTHENGTLE
IYRTTEEDAGSYSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIPKSHVLELYCESQC
DSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDST
SEKTQVTVLGVPDPPGNLHLSERQNRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWE
ELTRVQGEETDVVLSLAPYVRYQFRVTAVNEVGRSHASLPSDHHETPPAAPDKNPQNIRV
QASQPKEMIIKWEPLKSMEQNGPGLEYKVSWKPQGAPEEWEEEIVTNHTLRVMTPTVYAP
YDVKVQAINQLGSSPDPQPVTLYSGEDYPSTAPVIQRVDVMNSTLVKVTWSSIPKETVHG
LLRGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDPFSEFHLTVLAYNSKGA
GPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTY
ELGELNEINVTTPSKSSWHLSNLNSTTKYKFYLRACTSRGCGKPISEEGATLGEGSKGIR
KITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGREYAGLYDDIST
QGWFIGLMCAIALLTLILLTICFVKRNRGGKYSVKEKEDLHPDPEVQSAKDETFGEYSDS
DEKPLKGSLRSLNRNMQPTESADSLVEYGEGDQSIFNEDGSFIGAYTGAKEKGSVESNGS
STATFPLRA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cell adhesion molecule with homology to L1CAM contains a PF07679 domain.

Cell adhesion molecule with homology to L1CAM contains a PF07679 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00047 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00047 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00041 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00041 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00041 domain.

Cell adhesion molecule with homology to L1CAM contains a PF00041 domain.

Cell adhesion molecule with homology to L1CAM contains a PF07686 domain.

Cell adhesion molecule with homology to L1CAM is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. VLVP-GAEH.

Cell adhesion molecule with homology to L1CAM is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. SWKP-QGAP.