cDNA, FLJ95693, Homo sapiens nuclear factor (erythroid-derived 2)-like 2 (NFE2L2),mRNA (Nuclear factor (Erythroid-derived 2)-like 2, isoform CRA_b)

UniProt : B2RBU2, Q16236, UniProt ID: B2RBU2_HUMAN, NF2L2_HUMAN,

cDNA, FLJ95693, Homo sapiens nuclear factor (erythroid-derived 2)-like 2 (NFE2L2),mRNA (Nuclear factor (Erythroid-derived 2)-like 2, isoform CRA_b)

Homo sapiens

MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95693, Homo sapiens nuclear factor (erythroid-derived 2)-like 2 (NFE2L2),mRNA (Nuclear factor (Erythroid-derived 2)-like 2, isoform CRA_b) contains a PF00170 domain.

cDNA, FLJ95693, Homo sapiens nuclear factor (erythroid-derived 2)-like 2 (NFE2L2),mRNA (Nuclear factor (Erythroid-derived 2)-like 2, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. TEVD-NYHF.

cDNA, FLJ95693, Homo sapiens nuclear factor (erythroid-derived 2)-like 2 (NFE2L2),mRNA (Nuclear factor (Erythroid-derived 2)-like 2, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. EELD-SAPG.