Collagen alpha-2(V) chain

UniProt : P05997, UniProt ID: CO5A2_HUMAN,

Collagen alpha-2(V) chain

Homo sapiens

MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGL
VPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPG
EPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHG
MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG
AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
EDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSP
NTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIR
FRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01410 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF01391 domain.

Collagen alpha-2(V) chain contains a PF00093 domain.

Collagen alpha-2(V) chain is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. EFTE-DQAA.

Collagen alpha-2(V) chain is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-LRGD.