NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N)

UniProt : P30990, Q6FH20, UniProt ID: NEUT_HUMAN, Q6FH20_HUMAN,

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N)

Homo sapiens

MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN
VCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE
LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N) contains a PF07421 domain.

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N) is proteolytically cut by oligopeptidase B (S09.010) cleavage. KPRR-PYIL.

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N) is proteolytically cut by oligopeptidase B (S09.010) cleavage. KPRR-PYIL.

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N) is proteolytically cut by calpain-1 (C02.001) cleavage. RQLY-ENKP.

NTS protein (Neurotensin, isoform CRA_b) (cDNA, FLJ92347, Homo sapiens neurotensin (NTS), mRNA) (Preproneurotensin/neuromedin N) is proteolytically cut by chymase (S01.140) cleavage. RRPY-ILKR.