Ras GTPase-activating protein 1

UniProt : P20936, UniProt ID: RASA1_HUMAN,

Ras GTPase-activating protein 1

Homo sapiens

MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLP
TSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQ
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQE
AYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISM
EDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFV
FLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
HVLKKLLAITELLQQKQNQYTKTNDVR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ras GTPase-activating protein 1 contains a PF00616 domain.

Ras GTPase-activating protein 1 contains a PF00169 domain.

Ras GTPase-activating protein 1 contains a PF00168 domain.

Ras GTPase-activating protein 1 contains a PF00018 domain.

Ras GTPase-activating protein 1 contains a PF00017 domain.

Ras GTPase-activating protein 1 contains a PF00017 domain.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DTVD-GKEI.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-8 (C14.009) cleavage..

Ras GTPase-activating protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DTVD-GKEI.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-8 (C14.009) cleavage..

Ras GTPase-activating protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. TVDG-KEIY.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. EGDS-LDGP.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. EGDS-LDGP.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. TVDG-KEIY.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. DTVD-GKEI.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DEGD-SLDG.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-7 (C14.004) cleavage. DEGD-SLDG.

Ras GTPase-activating protein 1 is proteolytically cut by caspase-6 (C14.005) cleavage..