BMP-binding endothelial regulator protein

UniProt : Q8CJ69, UniProt ID: BMPER_MOUSE,

BMP-binding endothelial regulator protein

Mus musculus

MLWFFSVRALAERPCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTHEGRTYNSSFK
WQTPAEPCVLRQCQEGVVTESEVRCVVHCKNPAEHQGACCPTCPGCVFEGVQYREGEEFQ
PEGNKCITCSCVGGRTQCVREVCPILSCPQHLSHTPSGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGASFVYDNCTVCTCKDSTMVCKKKCSHPGVCNSDEDACCEDCLLRVPPEDIKV
CKFGSKIFRDGEMWSSVNCSICACVKGKTECRKKQCVPVSSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VELMLGESTVSLQQHLTVRWNGSRIALPCHTPHFHIDLDGYLLKVTTRAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYTTFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIKVHWEPQQSCAATQCKHGAVYDTCGPGCVKTCDNWNEIGPCNKPCI
AGCHCPANLVLHKGRCIKPVLCPQR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

BMP-binding endothelial regulator protein contains a PF00093 domain.

BMP-binding endothelial regulator protein contains a PF00093 domain.

BMP-binding endothelial regulator protein contains a PF00093 domain.

BMP-binding endothelial regulator protein contains a PF00094 domain.

BMP-binding endothelial regulator protein contains a PF01826 domain.

BMP-binding endothelial regulator protein contains a PF08742 domain.

BMP-binding endothelial regulator protein is proteolytically cut by tolloid (M12.010) cleavage. QFYG-DPSF.