Proclotting enzyme

UniProt : P21902, UniProt ID: PCE_TACTR,

Proclotting enzyme

Tachypleus tridentatus

MLVNNVFSLLCFPLLMSVVRCSTLSRQRRQFVFPDEEELCSNRFTEEGTCKNVLDCRILL
QKNDYNLLKESICGFEGITPKVCCPKSSHVISSTQAPPETTTTERPPKQIPPNLPEVCGI
HNTTTTRIIGGREAPIGAWPWMTAVYIKQGGIRSVQCGGALVTNRHVITASHCVVNSAGT
DVMPADVFSVRLGEHNLYSTDDDSNPIDFAVTSVKHHEHFVLATYLNDIAILTLNDTVTF
TDRIRPICLPYRKLRYDDLAMRKPFITGWGTTAFNGPSSAVLREVQLPIWEHEACRQAYE
KDLNITNVYMCAGFADGGKDACQGDSGGPMMLPVKTGEFYLIGIVSFGKKCALPGFPGVY
TKVTEFLDWIAEHMV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proclotting enzyme contains a PF00089 domain.

Proclotting enzyme is proteolytically cut by coagulation factor G {{Tachypleus}}, activated (S01.222) cleavage. TTTR-IIGG.

Proclotting enzyme is proteolytically cut by coagulation factor B {{Limulus}, {Tachypleus}}, activated (S01.220) cleavage. TTTR-IIGG.