BlaR1

UniProt : Q6UB83, UniProt ID: Q6UB83_STAAU,

BlaR1

Staphylococcus aureus

MLVFFRYILKRYFNYSLNYKVWYLTVLAGLIPFIPIKFSFIKFNNVNNQSPTVESRSHDL
NHNINTTKPVQEFTTDIHKFNWDSIDNICTVIWIVLVIILSFKFLKSLLYLKYLKRQSLY
LNENEKNKIDTILFNHQYKKNIVIRKAETIQSPITFWYGKYIILIPSSYFKSVIDKRLKY
IILHEYAHAKNRDTLHLIIFNIFSIVMSYNPLIHIVKRKIIHDNEVEADRFVLNNINKNE
FKTYAESIMDSVLNIPFFNKNILSHSFNGKKSLLKRRLINIKEANLKKQSKLIPIFICIF
TFLLMVIQSQFLMGQSITDYNYKKPLQNDHQILDESKNFGSNSGSFVMYSMKKDKYYIYN
EKESRKRYSPDSTYKIYLAMFGLDHHIISDKNSRMSWNHKHYPFESWNKEQDLNTAMQNS
VNWYFERISNQIPKNYTAAQLKQLNYGNENLGSYKSYWMEDSLKISNLEQVIVFKNMMEQ
NNHFSKKAKNQLSSSLLIKKNEKYELYGNTGTGIVNGKYNNGWFVGYVITNHDKYYFATH
LSDGKPSGKNAELISEKILKEMGVLNGQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

BlaR1 contains a PF00905 domain.

BlaR1 contains a PF05569 domain.

BlaR1 is proteolytically cut by BlaR1 peptidase (M56.001) cleavage. LLKR-RLIN.