Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (Protein phosphatase 2, regulatory subunit B (B56), gamma isoform, isoform CRA_e) (Fragment)

UniProt : B5BUA5, Q13362, UniProt ID: 2A5G_HUMAN, B5BUA5_HUMAN,

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (Protein phosphatase 2, regulatory subunit B (B56), gamma isoform, isoform CRA_e) (Fragment)

Homo sapiens

MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (Protein phosphatase 2, regulatory subunit B (B56), gamma isoform, isoform CRA_e) (Fragment) contains a PF01603 domain.

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (Protein phosphatase 2, regulatory subunit B (B56), gamma isoform, isoform CRA_e) (Fragment) is proteolytically cut by caspase () cleavage. MVVD-AANS.