Hemoglobin subunit beta

UniProt : P02070, UniProt ID: HBB_BOVIN,

Hemoglobin subunit beta

Bos taurus

MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVK
AHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKE
FTPVLQADFQKVVAGVANALAHRYH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemoglobin subunit beta contains a PF00042 domain.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. ADAV-MNNP.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. FESF-GDLS.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. TQRF-FESF.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. VTAF-WGKV.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. GRLL-VVYP.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. LGRL-LVVY.

Hemoglobin subunit beta is proteolytically cut by cathepsin D (A01.009) cleavage. TAEE-KAAV.