ATP synthase subunit alpha, mitochondrial

UniProt : P15999, UniProt ID: ATPA_RAT,

ATP synthase subunit alpha, mitochondrial

Rattus norvegicus

MLSVRIAAAVARALPRRAGLVSKNALGSSFVGTRNLHASNTRLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSKIRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFESAFLSHVVSQHQSLLGNIRSDGKISEQSDAKL
KEIVTNFLAGFEP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ATP synthase subunit alpha, mitochondrial contains a PF00006 domain.

ATP synthase subunit alpha, mitochondrial contains a PF00306 domain.

ATP synthase subunit alpha, mitochondrial contains a PF02874 domain.

ATP synthase subunit alpha, mitochondrial is proteolytically cut by caspase-3 (C14.003) cleavage..

ATP synthase subunit alpha, mitochondrial is proteolytically cut by calpain-2 (C02.002) cleavage..