Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6

UniProt : P29350, Q53XS4, UniProt ID: P29350-3, Q53XS4_HUMAN,

Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6

Homo sapiens

MLSRGWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSG
DFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGG
QAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTV
GGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESED
TAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPG
SDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGR
NKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWP
DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGL
DCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGN
ITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6 contains a PF00017 domain.

Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6 contains a PF00102 domain.

Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6 contains a PF00017 domain.

Isoform 2 of Tyrosine-protein phosphatase non-receptor type 6 is proteolytically cut by calpain-1 (C02.001) cleavage..