Putative uncharacterized protein CIS308

UniProt : Q59QL4, UniProt ID: Q59QL4_CANAL,

Putative uncharacterized protein CIS308

Candida albicans

MLSLTKPPTATATATTHTETKTINTAQISLQIFSFFFVSFHHYLIKYQINQLTNSIIMRF
SIATLSLAAFTVVSAGYISRGEGLTRGEKHERHECDFDSFEWKFGLAVKELKHHGDKNWG
RDVELDLVYESDDGQLYHGCKDVYKASKCRNCYETFEFSDNESSDDEGSGSDCEDDECKK
RKKKVHRNYKRGGYGSERRQSDCESDCERSERCNYPFCELYEDNCDLLLTLCDGVLHDDR
HATGEIVANHQFQFDKPPQKDALHKKGFSIVYTHGNYYLALDNKIKFWHCKVDDNGLYKI
YDKSIGEQCCEIELIILKSDKKAEFEFTDRESDSEGSDCDDDCKKNKKHGKKHSGY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein CIS308 is proteolytically cut by kexin (S08.070) cleavage. NYKR-GGYG.

Putative uncharacterized protein CIS308 is proteolytically cut by kexin (S08.070) cleavage. SERR-QSDC.

Putative uncharacterized protein CIS308 is proteolytically cut by kexin (S08.070) cleavage. RSER-CNYP.