cDNA, FLJ94315, Homo sapiens ribonucleotide reductase M2 polypeptide (RRM2), mRNA

UniProt : B2R9B5, P31350, UniProt ID: B2R9B5_HUMAN, RIR2_HUMAN,

cDNA, FLJ94315, Homo sapiens ribonucleotide reductase M2 polypeptide (RRM2), mRNA

Homo sapiens

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94315, Homo sapiens ribonucleotide reductase M2 polypeptide (RRM2), mRNA contains a PF00268 domain.

cDNA, FLJ94315, Homo sapiens ribonucleotide reductase M2 polypeptide (RRM2), mRNA is proteolytically cut by caspase () cleavage. SLVD-KENT.