Fibrinogen alpha chain

UniProt : P06399, UniProt ID: FIBA_RAT,

Fibrinogen alpha chain

Rattus norvegicus

MLSLRVACLILSLASTVWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFCSDED
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQKNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTFGQVSEDLRRRIQILKRKVIEKAQQIQVLQKDVRDQLIDMKRLEVDIDIKIRS
CKGSCSRSVSREINLKDYEGQQKQLEQVIAKDLLPAKDRQYLPAIKMSPVPDLVPGSFKS
QLQEGPPEWKALTEMRQMRMELERPGKDGASRGDLPGDSRGDSATRGPGSKIENPMTPGH
GGSGYWRPGSSGSGSDGNWGSGTTGSDDTGTWGAGSSRPSSGSGNLKPSNPDWGEFSEFG
GSSSPATRKEYHTGKLVTSKGDKELLIGNEKVTSTGTSTTRRSCSKTITKTVLGNDGHRE
VVKEVVTSDDGSDCGDGMDLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTSNFKEFGS
KTSDSDIFTDIENPSSHVPEFSSSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRG
RARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLN
FNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELEDWAGKEAYAEYHFRV
GSEAEGYALQVSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYG
GGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVLWVPFRGADYSLWAVRMKIRPLV
GQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fibrinogen alpha chain contains a PF00147 domain.

Fibrinogen alpha chain contains a PF08702 domain.

Fibrinogen alpha chain is proteolytically cut by thrombin (S01.217) cleavage. GDIR-GPRI.