Ac1873

UniProt : Q7TQ70, UniProt ID: Q7TQ70_RAT,

Ac1873

Rattus norvegicus

MLSLRVACLILSLASTVWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFCSDED
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQKNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTFGQVSEDLRRRIEILKRKVIEKAQQIQVLQKDVRDQLIDMKRLEVDIDIKIRS
CKGSCSRSVSREINLKDYEGQQKQLEQVIAKELLPAKDRQYLPAIKMSPVPDLVPGSFKS
QLQEGPPEWKALTEMRQMRMELERPGKDGASRGDLPGDSRGDSATRGPGSKIENPMTPGH
GGSGYWRPGSSGSGSDGNWGSGTTGSDDTGTWGAGSSRPSSGSGNLKPSNPDWGEFSEFG
GSSSPATRKEYHTGKLVTSKGDKELLIGNEKVTSTGTSTTRRSCSKTITKTVLGNDGHRE
VVKEVVTSDDGSDCGDGMDLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTSNFKEFGS
KTSDSDIFTDIENPSSHVPEFSSSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRG
RARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLN
FNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELEDWAGKEAYAEYHFRV
GSEAEGYALQVSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYG
GGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLV
GQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ac1873 contains a PF00147 domain.

Ac1873 contains a PF08702 domain.

Ac1873 is proteolytically cut by gabonase (S01.430) cleavage. GGVR-GPRL.

Ac1873 is proteolytically cut by thrombin (S01.217) cleavage. GGVR-GPRV.

Ac1873 is proteolytically cut by Ancrod (S01.178) cleavage. GGVR-GPRL.

Ac1873 is proteolytically cut by crotalase (S01.177) cleavage. GGVR-GPRL.

Ac1873 is proteolytically cut by batroxobin (S01.176) cleavage. GGVR-GPRL.

Ac1873 is proteolytically cut by lebetase (M12.164) cleavage. FFSP-MLGE.

Ac1873 is proteolytically cut by lebetase (M12.164) cleavage. HTEK-LVTS.

Ac1873 is proteolytically cut by basilysin (M12.148) cleavage. SSSY-SKQF.

Ac1873 is proteolytically cut by basilysin (M12.148) cleavage. DTAS-TGKT.

Ac1873 is proteolytically cut by basilysin (M12.148) cleavage. HTEK-LVTS.