Collagen alpha-2(I) chain

UniProt : P02466, UniProt ID: CO1A2_RAT,

Collagen alpha-2(I) chain

Rattus norvegicus

MLSFVDTRTLLLLAVTSCLATCQSLQMGSVRKGPTGDRGPRGQRGPAGPRGRDGVDGPVG
PPGPPGAPGPPGPPGPPGLTGNFAAQYSDKGVSAGPGPMGLMGPRGPPGAVGAPGPQGFQ
GPAGEPGEPGQTGPAGSRGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLP
GFKGIRGHNGLDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGAR
GSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEAGLPGLSGPV
GPPGNPGANGLTGAKGATGLPGVAGAPGLPGPRGIPGPVGAAGATGPRGLVGEPGPAGSK
GETGNKGEPGSAGAQGPPGPSGEEGKRGSPGEPGSAGPAGPPGLRGSPGSRGLPGADGRA
GVMGPPGNRGSTGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPAGKEGPVGLPGID
GRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGEKGHPGLAGARGAPGPDGNNGAQGPP
GPQGVQGGKGEQGPAGPPGFQGLPGPSGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPP
GESGAAGPSGPIGIRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGK
GEKGETGLRGEIGNPGRDGARGAPGAIGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGER
GEVGPAGPNGFAGPAGSAGQPGAKGEKGTKGPKGENGIVGPTGPVGAAGPSGPNGPPGPA
GSRGDGGPPGMTGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGIRGPRGDQGPVGRTGEI
GASGPPGFAGEKGPSGEPGTTGPPGTAGPQGLLGAPGILGLPGSRGERGQPGIAGALGEP
GPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGNI
GPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDK
GARGLPGLKGHNGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPIGKDGRSGHPGPV
GPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGGFYRADQPRSQPSLRPKDYE
VDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWKSDYYWIDPNQGCTMDAIKVY
CDFSTGETCIQAQPVNTPAKNAYSRAQANKHVWLGETINGGSQFEYNAEGVSSKEMATQL
AFMRLLANRASQNITYHCKNSIAYLDEETGRLNKAVILQGSNDVELVAEGNSRFTYTVLV
DGCSKKTNEWDKTVIEYKTNKPSRLPFLDIAPLDIGGTNQEFRVEVGPVCFK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01410 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain is proteolytically cut by cathepsin K (C01.036) cleavage. AGAR-GSDG.

Collagen alpha-2(I) chain is proteolytically cut by cathepsin K (C01.036) cleavage. AGAR-GSDG.

Collagen alpha-2(I) chain is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GPSG-ITGP.

Collagen alpha-2(I) chain is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GPQG-LLGA.

Collagen alpha-2(I) chain is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GPLG-IAGP.