Collagen alpha-2(I) chain

UniProt : P02465, UniProt ID: CO1A2_BOVIN,

Collagen alpha-2(I) chain

Bos taurus

MLSFVDTRTLLLLAVTSCLATCQSLQEATARKGPSGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGNFAAQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGE
PGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGH
NGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGP
VGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGA
NGLPGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGE
PGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRGNPGSRGLPGADGRAGVMGPAGS
RGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPIGP
AGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGG
KGEQGPAGPPGFQGLPGPAGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGP
TGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSGLPGERGAAGIPGGKGEKGETGL
RGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPAGP
NGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGP
PGATGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGF
VGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRGERGLPGVAGSVGEPGPLGIAGP
PGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAAGA
PGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGL
KGHNGLQGLPGLAGHHGDQGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGS
QGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRADQPRSPTSLRPKDYEVDATLKSL
NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGET
CIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLAN
HASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTN
EWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCFK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01410 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain contains a PF01391 domain.

Collagen alpha-2(I) chain is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPQG-LLGA.