Collagen alpha-2(I) chain (Fragments)

UniProt : P02467, UniProt ID: CO1A2_CHICK,

Collagen alpha-2(I) chain (Fragments)

Gallus gallus

MLSFVDTRILLLLAVTSYLATSQHVSEASAGRKGPRGDKGPQGERGPPGPPGRDGEDGPP
GPPGPPGPPGLGGNFAAQYDPSKAADFGPGPMGLMGPRGPPGASGPPGPPGFQGVPGEPG
EPGQTGPQGPRGPPGPPGKAGEDGHPGKPGRPGERGVAGPQGARGFPGTPGPPGFKGIRG
HNGLDGLTGQPGAPGTKGEPGAPGENGTPGQPGARGLPGERGRIGAPGPAGARGSDGSAG
PTGPAXXXXXXXXXXXXXXXXXGEIGPAGNEGPTGPAGPRGEIGLPGSSGPVGPPGNPGA
NGLPGAKGAAGLPGVAGAPGLPGPRGIPGPPGPAGPSGARGLVGEPGPAGAKGESGNKGE
PGAAGPPGPPGPSGEEGKRGSNGEPGSAGPPGPAGLRGEPGSRGLPGADGRAGVMGPAGN
RGASGPVGAKGPNGDAGRPGEPGLMGPRXXXXXXXXXXXXXXXXXXGFPGADGRVGPIGP
AGNRGEPGNIGFPGPKGPTGEPGKPGEKGNVGLAGPRGAPGPEGNNGAQGPPGVTGNQGA
KGETGPAGPPGFQGLPGPSGPAGEAGKPGERGLHGEFGVPGPAGPRGERGLPGESGAVGP
AGPIGSRGPSGPPGPDGNKGEPGNVGPAGAPGPAGPGGIPGERGVAGVPGGKGEKGAPGL
RGDTGATGRDGARGLPGAIGAPGPAGGAGDRGEGGPAGPAGPAGARGIPGERGEPGPVGP
SGFAGPPGAAGQPGAKGERGPKGPKGETGPTGAIGPIGASGPPGPVGAAGPAGPRGDAGP
PGMTGFPGAAGRVGPPGPAGITGPPGPPGPAGKDGPRGLRGDVGPVGRTGEQGIAGPPGF
AGEKGPSGEAGAAGPPGTPGPQGILGAPGILGLPGSRGERGLPGIAGATGEPGPLGVSGP
PGARGPSGPVGSPGPNGAPGEAGRDGNPGNDGPPGRDGAPGFKGERGAPGNPGPSGALGA
PGPHGQVGPSGKPGNRGDPGPVGPVGPAGAFGPRGLAGPQGPRGEKGEPGDKGHRGLPGL
KGHNGLQGLPGLAGQHGDQGPPGNNGPAGPRGPPGPSGPPGKDGRNGLPGPIGPAGVRGS
HGSQGPAGPPGPPGPPGPPGPNGGGYEVGFDAEYYRADQPSLRPKDYEVDATLKTLNNQI
ETLLTPEGSKKNPARTCRDLRLSHPEWSSGFYWIDPNQGCTADAIRAYCDFATGETCIHA
SLEDIPTKTWYVSKNPKDKKHIWFGETINGGTQFEYNGEGVTTKDMATQLAFMRLLANHA
SQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELRAEGNSRFTFSVLVDGCSKKNNKW
GKTIIEYRTNKPSRLPILDIAPLDIGGADQEFGLHIGPVCFK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-2(I) chain (Fragments) contains a PF01410 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) contains a PF01391 domain.

Collagen alpha-2(I) chain (Fragments) is proteolytically cut by procollagen I N-peptidase (M12.301) cleavage. NFAA-QYDP.