cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a)

UniProt : B2R5G3, P61278, UniProt ID: B2R5G3_HUMAN, SMS_HUMAN,

cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a)

Homo sapiens

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a) contains a PF03002 domain.

cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a) is proteolytically cut by nardilysin (M16.005) cleavage. PRER-KAGC.

cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a) is proteolytically cut by (M9G.026) cleavage. CKNF-FWKT.

cDNA, FLJ92464, Homo sapiens somatostatin (SST), mRNA (Somatostatin, isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage. FWKT-FTSC.