Somatostatin

UniProt : P60042, UniProt ID: SMS_RAT,

Somatostatin

Rattus norvegicus

MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEP
NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Somatostatin contains a PF03002 domain.

Somatostatin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RERK-AGCK.

Somatostatin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RERK-AGCK.

Somatostatin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RERK-AGCK.

Somatostatin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RERK-AGCK.