Somatostatin
|
Somatostatin Rattus norvegicus MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEP NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Somatostatin contains a PF03002 domain.
Somatostatin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RERK-AGCK.
Somatostatin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RERK-AGCK.
Somatostatin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RERK-AGCK.
Somatostatin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. RERK-AGCK.