Bos taurus

MLRPQTPGRALPLWRRSPAEHQSVRWMHEDPRELSRGQSCGGPEPRAGAAESAGRPRLAP
RRQRNGAWSRCYRRAAPRGARVRPEPARRSRGEVVGARAAGGRPGSRRQCLPGSQEAREA
GEERRARPALGAAARLRRRASKDESAAPETAAPTPKAAPEPRDPARLGPGRWEAARTPRC
PQPGETIAARWVTSPRAASEDSRLRMGNHAGKRDFGAEKGNKDSETNRGEHEKKRNTRDL
SREISEDSDVFGAADVVPNNGAPSQDTAVTDSKRTADPKNAWPEASPADPGGRPHLVRLF
SRDAPGREDNTFKDRPSESDELQTIQEDSAAAPGAVDAMAAQKRPSQRSKYLASASTMDH
ARHGFLPRHRDTGILDSLGRFFGSDRGAPKRGSGKVPWLKQSKSPLGPHARSPPGLCNMY
QDGHHAARTTHYGSLPQKAQHGRPQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSW
GAEGQKPGFGYGGRASDYKSAHKGLKGHDAQGTLSKIFKLGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. LASA-STMD.

is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. HAAR-TTHY.

is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. VVHF-FKNI.

is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. KYLA-SAST.

is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. GSLP-QKAQ.

is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. LASA-STMD.

is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHAA-RTTH.

is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. LASA-STMD.

is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. GSLP-QKAQ.

is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. DYKS-AHKG.

is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. GLSL-SRFS.

is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. LPQK-AQHG.