Dibasic-processing endoprotease

UniProt : P42781, UniProt ID: XPR6_YARLI,

Dibasic-processing endoprotease

Yarrowia lipolytica

MLRKFILGLLLASQAVAQLPHKERDYDSRVYVALSLRDGLDPREFEASVSGLDHGQWTFE
HPVGTIPNTYVFSAPKEYAPIENIRDQDRLEVAGGVLAKRELRKREKLQKKYGMSEEDVE
KRLVALERLDYDWSERGLGSLEVLSERRIHKRAPVNWTEEEMEYLKEIKRRAEEAQKAQD
DKGDKKEDQKDDKKEGQEAQKEGDKEDNKGDDKEDGEEDDDDDEDEDDDDASPAMPVQWK
PVDESMYGGMPDDSLYDVYRKYYPDEVGIKDPSLWKQWYLHNVHKAGHDLNVTGLWLRNV
TGWGVVTAVVDDGLDMNAEDIKANYFAEGSWDFNFNKSDPKPSSHDDYHGTRCAGEIAAV
RNNVCGVGVAYDSKVAGIRILSKEIAEDIEALAINYEMDKNDIYSCSWGPPDNGQTMARP
GKVVKDAMVNAITNGRQGKGNVFVFASGNGGSRGDNCNFDGYTNSIYSITVGALDFNDGH
PYYSEACSANMVVTYSSGSEHYIVGTDINAIDDKSAAPRCQNQHGGTSAAAPLAAGVFAL
ALSVRPDLTWRDMQYLALYSAVEINSNDDGWQDTASGQRFHHQFGYGKLDASKIVELAEG
WNLVNNQTSFHSEVKTVSQKVKYNEPLKSVITVTRDDLDKVNFKRAEHITAVLNLEASYR
GHVRVLLKGPRGVVSELAALRRDDRSKDGYDNWAFMSVAHWADEGEGDWELTVENTGEQD
QVELVNWQLNVFGEQKDKREENKEGESKPEDENKEGEKEGEKKPEDENKEEGNKEDDKGD
QKEDKPEDKPEDKPEDTPEDKPEDKPEDAPEDKPSDEKKPEEKPEEKPVDNSDSSSDSSD
SHTSWWPDLSSKKSAWLYGAVLLVGGFIAVIGIYACVTRRNRVRRNRSKDAPSASSFEFD
LIPHDDSDDDFVYPEDTHRRSGDNDRLYDPFAEVEDDDDMFRISDEGEDAHDVEPELNRV
SMEADKRDNDRQNLLG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Dibasic-processing endoprotease contains a PF00082 domain.

Dibasic-processing endoprotease contains a PF01483 domain.

Dibasic-processing endoprotease is proteolytically cut by kexin (S08.070) cleavage. IHKR-APVN.