Platelet glycoprotein V

UniProt : P40197, UniProt ID: GPV_HUMAN,

Platelet glycoprotein V

Homo sapiens

MLRGTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHILLFGM
GRGVLQSQSFSGMTVLQRLMISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGALLDK
MVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGN
NLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDR
LPNLSSLTLSRNHLAFLPSALFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRT
QLRTLPAAAFRNLSRLRYLGVTLSPRLSALPQGAFQGLGELQVLALHSNGLTALPDGLLR
GLGKLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDVFGALPRLTEVLLGH
NSWRCDCGLGPFLGWLRQHLGLVGGEEPPRCAGPGAHAGLPLWALPGGDAECPGPRGPPP
RPAADSSSEAPVHPALAPNSSEPWVWAQPVTTGKGQDHSPFWGFYFLLLAVQAMITVIIV
FAMIKIGQLFRKLIRERALG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF01463 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V contains a PF00560 domain.

Platelet glycoprotein V is proteolytically cut by thrombin (S01.217) cleavage. PGPR-GPPP.