Homo sapiens

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSD
NAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIA
PRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISV
KWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGE
SQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSA
QWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRT
IKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLL
VSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQ
KSEPLIGRKKTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTT
ATPIRHRPRPYPPNVGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTS
ATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYA
VGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSC
TCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRP
GGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GFRR-TTPP.

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. TDVR-AAVY.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. AAVY-QPQP.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ITIY-AVEE.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VSVY-TVKD.

is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..

is proteolytically cut by neuropsin (S01.244) cleavage. TDVR-AAVY.

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GFRR-TTPP.

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. TDVR-AAVY.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. AAVY-QPQP.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ITIY-AVEE.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VSVY-TVKD.

is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..

is proteolytically cut by neuropsin (S01.244) cleavage. TDVR-AAVY.

is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TNLH-LEAN.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TGYR-ITTT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QTYP-SSSG.

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GFRR-TTPP.

is proteolytically cut by kallikrein hK2 (S01.161) cleavage. TDVR-AAVY.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. AAVY-QPQP.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ITIY-AVEE.

is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VSVY-TVKD.

is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..

is proteolytically cut by neuropsin (S01.244) cleavage. TDVR-AAVY.

is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. NSHP-IQWN.

is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPVE-VFIT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TNLH-LEAN.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. HPIQ-WNAP.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TGYR-ITTT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QTYP-SSSG.

is proteolytically cut by apolipoprotein (S01.999) cleavage..