Protein TOS1

UniProt : P38288, UniProt ID: TOS1_YEAST,

Protein TOS1

Saccharomyces cerevisiae

MLQKLSMTALVGLFSSVVSLVNADCTYSGGNYYCAQTDAIIYSNVGLSATYQDVTNMDES
SCACTQADFTASGSLAPFNEELSVHFRGPIELLQFGVYYPNGESNALKKRSEKQSIESCK
EGEAVVSRHKHQHKRDVAVEYVQVTSTVYVDSNGQTVTADSTNTVVGPAVPSSYTKDSTV
LSSSAQAVETSESQSSISSSKTTSSAAAASSSSSSSSNTNGDWSRGSYFVPGSTSNCTFM
NNQGGTAGSGVWSSCFGNSISFAASDGVSGAASAQALGDVTIKSGNEFMIFSGEECSGNN
GDCGYYREGIPAYHGFGGADKIFVFEFSMPSDTSGSAYNQDMPAIWLLNAKIPRTLQYGD
ASCSCWKTGCGEMDLFEILTAGSDKLISHIHDGQDGGTQDYFERPTDGTLKAAVIFNSSD
KTIHIIEVDESFDATLSDDVVDQWLSKSGSSAALP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein TOS1 is proteolytically cut by kexin (S08.070) cleavage. LKKR-SEKQ.

Protein TOS1 is proteolytically cut by kexin (S08.070) cleavage. QHKR-DVAV.