Insulin-like growth factor-binding protein 2

UniProt : P18065, UniProt ID: IBP2_HUMAN,

Insulin-like growth factor-binding protein 2

Homo sapiens

MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPP
VAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGS
ELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAG
RKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLER
ISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGA
PTIRGDPECHLFYNEQQEARGVHTQRMQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor-binding protein 2 contains a PF00086 domain.

Insulin-like growth factor-binding protein 2 contains a PF00219 domain.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GARA-EVLF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GMKE-LAVF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HHLG-LEEP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EPKK-LRPP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EQHR-QMGK.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GARA-EVLF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GMKE-LAVF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HHLG-LEEP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EPKK-LRPP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EQHR-QMGK.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

Insulin-like growth factor-binding protein 2 is proteolytically cut by pappalysin-1 (M43.004) cleavage..

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GARA-EVLF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GMKE-LAVF.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HHLG-LEEP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EPKK-LRPP.

Insulin-like growth factor-binding protein 2 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EQHR-QMGK.

Insulin-like growth factor-binding protein 2 is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

Insulin-like growth factor-binding protein 2 is proteolytically cut by pappalysin-1 (M43.004) cleavage..

Insulin-like growth factor-binding protein 2 is proteolytically cut by kallikrein hK14 (S01.029) cleavage..