PMAP: SubstrateDB : Putative uncharacterized protein

Putative uncharacterized protein

UniProt : Q06141, Q53S56, UniProt ID: Q53S56_HUMAN, REG3A_HUMAN,

Putative uncharacterized protein

Homo sapiens

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00059 domain.

Putative uncharacterized protein is proteolytically cut by cationic trypsin (S01.127) cleavage. PSAR-IRCP.