Complement component 1 Q subcomponent-binding protein, mitochondrial
|
UniProt : Q07021, UniProt ID: C1QBP_HUMAN, Complement component 1 Q subcomponent-binding protein, mitochondrial Homo sapiens MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLR PRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKL VRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKK ALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLM DFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Complement component 1 Q subcomponent-binding protein, mitochondrial contains a PF02330 domain.
Complement component 1 Q subcomponent-binding protein, mitochondrial is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PSQG-QKVE.