Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a)

UniProt : A0N9W2, P22692, UniProt ID: A0N9W2_HUMAN, IBP4_HUMAN,

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a)

Homo sapiens

MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) contains a PF00086 domain.

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) contains a PF00219 domain.

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage..

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage..

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by pappalysin-1 (M43.004) cleavage. GGKM-KVNG.

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by cathepsin D (A01.009) cleavage. GGKM-KVNG.

Insulin-like growth factor binding protein 4 (Insulin-like growth factor binding protein 4, isoform CRA_a) is proteolytically cut by pappalysin-1 (M43.004) cleavage..