Isoform APP695 of Amyloid beta A4 protein

UniProt : P05067, UniProt ID: P05067-4,

Isoform APP695 of Amyloid beta A4 protein

Homo sapiens

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVRVPTTAASTPDAV
DKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHF
QEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLK
KYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVA
EEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSL
DDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEF
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGV
VEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform APP695 of Amyloid beta A4 protein contains a PF03494 domain.

Isoform APP695 of Amyloid beta A4 protein contains a PF02177 domain.

Isoform APP695 of Amyloid beta A4 protein contains a PF00014 domain.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. KLVF-FAED.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKGA-IIGL.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AIIG-LMVG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IIGL-MVGG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage. EVKM-DAEF.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. KLVF-FAED.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKGA-IIGL.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AIIG-LMVG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IIGL-MVGG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage. EVKM-DAEF.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by memapsin-1 (A01.041) cleavage. KLVF-FAED.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKGA-IIGL.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AIIG-LMVG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IIGL-MVGG.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage. EVKM-DAEF.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. LVFF-AEDV.

Isoform APP695 of Amyloid beta A4 protein is proteolytically cut by caspase-6 (C14.005) cleavage. VEVD-AAVT.