cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d)

UniProt : B2R5V1, P05067, UniProt ID: A4_HUMAN, B2R5V1_HUMAN,

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d)

Homo sapiens

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) contains a PF00014 domain.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) contains a PF02177 domain.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) contains a PF03494 domain.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LLPV-NGEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LLPV-NGEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IGLM-VGGV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LLPV-NGEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IGLM-VGGV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LLPV-NGEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IGLM-VGGV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-1 (A01.041) cleavage. KLVF-FAED.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-1 (A01.041) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase-6 (C14.005) cleavage. VKMD-AEFR.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage. VEVD-AAVT.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. KLVF-FAED.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. TYKF-FEQM.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. IVIT-LVML.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VITL-VMLK.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VVIA-TVIV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VIAT-VIVI.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. GGVV-IATV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. VVIA-TVIV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. EVKM-DAEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. RVEA-MLND.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. QPWH-SFGA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. VIAT-VIVI.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. DSGY-EVHH.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. VHHQ-KLVF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKGA-IIGL.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AIIG-LMVG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. DNVD-SADA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. DYAD-GSED .

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. VEVD-AAVT.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage. EVKM-DAEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. EVPT-DGNA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. GLLA-EPQR.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-5 (M10.023) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. LLPV-NGEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IGLM-VGGV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-1 (A01.041) cleavage. KLVF-FAED.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-1 (A01.041) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase-6 (C14.005) cleavage. VKMD-AEFR.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage. VEVD-AAVT.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. KLVF-FAED.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. TYKF-FEQM.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. IVIT-LVML.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VITL-VMLK.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VVIA-TVIV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. VIAT-VIVI.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. GGVV-IATV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. VVIA-TVIV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. EVKM-DAEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. RVEA-MLND.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. QPWH-SFGA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-3 (M10.016) cleavage. EVHH-QKLV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VLAN-MISE.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by presenilin 1 (A22.001) cleavage. VIAT-VIVI.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. DSGY-EVHH.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. VHHQ-KLVF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LVFF-AEDV.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NKGA-IIGL.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AIIG-LMVG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. IIGL-MVGG.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. DNVD-SADA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. DYAD-GSED .

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by caspase () cleavage. VEVD-AAVT.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage. EVKM-DAEF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. HHQK-LVFF.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. EVPT-DGNA.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by memapsin-2 (A01.004) cleavage. GLLA-EPQR.

cDNA, FLJ92638, Homo sapiens amyloid beta (A4) protein (proteasenexin-II, Alzheimer disease) (APP), mRNA (Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_d) is proteolytically cut by pitrilysin metallopeptidase 1 () cleavage. LVFF-AEDV.