Insulin-like growth factor-binding protein 4

UniProt : P47879, UniProt ID: IBP4_MOUSE,

Insulin-like growth factor-binding protein 4

Mus musculus

MLPFGLVAALLLAAGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDE
SEHPNNSFNPCSAHDHRCLQKHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALER
LAASQSRTHEDLFIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPK
GELDCHQLADSFQE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor-binding protein 4 contains a PF00219 domain.

Insulin-like growth factor-binding protein 4 contains a PF00086 domain.

Insulin-like growth factor-binding protein 4 is proteolytically cut by pappalysin-1 (M43.004) cleavage..

Insulin-like growth factor-binding protein 4 is proteolytically cut by pappalysin-1 (M43.004) cleavage..

Insulin-like growth factor-binding protein 4 is proteolytically cut by pappalysin-1 (M43.004) cleavage..