Putative uncharacterized protein

UniProt : Q3UIP2, Q61398, UniProt ID: PCOC1_MOUSE, Q3UIP2_MOUSE,

Putative uncharacterized protein

Mus musculus

MLPAALTSFLGPFLLAWVLPLARGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNK
KCIWTITVPEGQTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVV
APGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRMEKAQGTLTTPNWPESDYP
PGISCSWHIIAPSNQVIMLTFGKFDVEPDTYCRYDSVSVFNGAVSDDSKRLGKFCGDKAP
SPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESALSPGEDVQRGPQSRSDPK
TGTGPKVKPPTKPKSQPAETPEASPATQATPVAPAAPSITCPKQYKRSGTLQSNFCSSSL
VVTGTVKTMVRGPGEGLTVTVSLLGVYKTGGLDLPSPPSGTSLKLYVPCRQMPPMKKGAS
YLLMGQVEENRGPILPPESFVVLYRSNQDQILNNLSKRKCPSQPRTAA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00431 domain.

Putative uncharacterized protein contains a PF00431 domain.

Putative uncharacterized protein contains a PF01759 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..