|
Rattus norvegicus MLNTTLSACFLSLLALTSACYFQNCPRGGKRATSDMELRQCLPCGPGGKGRCFGPSICCA DELGCFLGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSDESCVAEPECREGF FRLTRAREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. GGKR-ATSD.
is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RLTR-AREQ.