Isoform 2 of Interferon-alpha/beta receptor beta chain

UniProt : P48551, Q6FHD7, UniProt ID: P48551-2, Q6FHD7_HUMAN,

Isoform 2 of Interferon-alpha/beta receptor beta chain

Homo sapiens

MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHS
IVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLF
SCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKK
HKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAE
SAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLAKGWNAVAIHRCSHNA
LQSETPELKQSSCLSFPSSWDYKRASLCPSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Interferon-alpha/beta receptor beta chain contains a PF09294 domain.

Isoform 2 of Interferon-alpha/beta receptor beta chain is proteolytically cut by () cleavage..

Isoform 2 of Interferon-alpha/beta receptor beta chain is proteolytically cut by () cleavage..

Isoform 2 of Interferon-alpha/beta receptor beta chain is proteolytically cut by () cleavage..