Enamelin

UniProt : O97939, UniProt ID: ENAM_PIG,

Enamelin

Sus scrofa

MLLSCRHGASSPKLDNLVPSGKMKILLVFLGLLCYSAAMPMQMPRMPGFSSKSEEMMRYG
HFNFMNAPHMAHLGTLYGNGMQLPQFFPQYQMPMWPQPPPNKKHPQKPSASKQQSKTDPA
PESQKPNQPQPKTPTPKQPLNEPSPTPTQPEEETQTPQAFPPFGNGLFPYQQPLWHVPHR
IPPGYGRPPTSNEEGGNPYFGFFGYHGFGGRPPYYSEEMFEQDFEKPKEKDPPKTETPAT
EPSVNTTVPETNSTQPNAPNPRGNDTSPTGTSGQGPNPRSNPTGQNGPAVNVSGQGVPRS
QSPWGPRQTIIHENYPNPNIRGFPARRQWRPPGPAMGHRRNGPFYRNQQIQRGPRWNSFT
LEGKQAVRPGYPTYRRVYGSTARSNPPNYAGNSANLRRKPEGPNKNPMVTNVAPPGPKHG
TVDQNENIQNPREKQVSQKERTVVPTRDPSGPWRNSQDYGINKSNYKLPQPEDNMLVPNF
NSIDQRENSYYPRGESKRAPNSDGQTQTQIIPKGIVLEPRRIPYESETNQPELKHSAYQP
VYTEGIPSPAKEHFPAGRNTWNQQEISPPFKEDPGRQEEHLPHLSHGSRVHVYYPDYNPY
DPRENSPYLRSNTWYERDDSPNTMGQPENPHYPMNTPDPKETIPYNEEDPIDPTGDEHFP
GQSRWDMEELSFKEDPTVRHYEGEQYTSNQPKEYLPYSLDNPSKPREDFLYGEFYPWNPE
ENFPSYNTAPTVSSPVESRGYYANNAVGQEESTMFPSWSSWDPRIQAQGQKEGRPYLNRN
FWDQSTNLYKTPTSSPHQKENQPYSNNSPAGLQKNPTWHEGENLNYGMQITRLNSPERDH
LAFPDLIPPDYPGGQKESHVFHLSQRGPCCAGGSMWPKNNPLALQDYTQSFGLAPGENPD
TSIGYAEDSHIKYARQTVSPTSIVPGQRNSSEKILPGESQNPSPFKDDVSTLRRSTPCSV
KSQLSQRGIMPLPEANSLQSKNTPCLTSDLGGDGNNVLEQIFEGNQLNERTVDLTPEQLV
FGTPDKEPRPEGIPNEMQGNESERQQQRQSSILQLPCFGSKLANYHTSSIGTPSSLGRQD
SFDGDPIMPTETPNSLAGLATGAQFQNINVDPLNEDEHTPFDSLQIGTNPQDQVQDCLLL
QA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Enamelin is proteolytically cut by kallikrein 4 (S01.251) cleavage. VPHR-IPPG.

Enamelin is proteolytically cut by kallikrein 4 (S01.251) cleavage. FFGY-HGFG.

Enamelin is proteolytically cut by kallikrein 4 (S01.251) cleavage. SEEM-FEQD.

Enamelin is proteolytically cut by kallikrein 4 (S01.251) cleavage. PNPR-GNDT.