Fibulin-2

UniProt : P37889, UniProt ID: FBLN2_MOUSE,

Fibulin-2

Mus musculus

MLLQESAGVWLALALVTALTPSPSMAVPWQDCTGAECPLLENCIEEALEPGACCATCVQQ
GCACEGYQYYDCVQGGFVDGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPNC
IEAVVVADSCPQCGQVGCVHSGRKYAAGHTVHLSSCRACHCPDAGGELICYQLPGCHGNF
SDAEEGDSERQYEDPYSYDQEVAEAEATTAIVNEVQAGAEGPPAALGGGNLPPSSIRVTP
WPVALPRPTAAAALGPPAPVQAKARRVTLDTEEDEEEEEEETLVTEPPTAGSPGRLDSLP
TRSPARPGFPVQEKEAEAKAGPEENLIPDAQVTPRSVMQEGAAPVPRSGLAALSPSLATD
SSSEDPVKPSDHPTLSTLPPDRAQVSPSPETPEEIPQHPQLLPRFRAEEDIDPNSVHSVP
RGDLDGSTKDLIETCCAAGQQWAIDNDECQEIPENGAQSDICRIAQRQCCISYLKEKSCV
AGVMGAKEGETCGAEDNDTCGVSLYKQCCDCCGLGLRVRAEGQSCESNPNLGYPCNHVML
SCCEGEEPLIVPEVRRPPEPEAAPRRVSEMEMASREALSLGTEAELPNSLPGDDQDECLM
LPGELCQHLCINTVGSYRCACFPGFELQGDGRTCRPDRGAPQLDTARESAPRSESAQVSP
NTIPLPVPQPNTCKDNGPCRQVCRVVGDTAMCSCFPGYAIMADGVSCEDQDECLMGTHDC
SWKQFCVNTLGSFYCVNHTVLCAEGYILNAHRKCVDINECVTDLHTCTRAEHCVNTPGSF
QCYKALTCEPGYVLTDGECTDVDECVTGTHNCQAGFSCQNTKGSFYCQARQRCMDGFLQD
PEGNCVDINECTSLLEPCRSGFSCINTVGSYTCQRNPLVCGRGYHANEEGSECVDVNECE
TGVHRCGEGQLCYNLPGSYRCDCKPGFQRDAFGRTCIDVNECWVSPGRLCQHTCENTPGS
YRCSCAAGFLLAADGKHCEDVNECETRRCSQECANIYGSYQCYCRQGYQLAEDGHTCTDI
DECAQGAGILCTFRCVNVPGSYQCACPEQGYTMMANGRSCKDLDECALGTHNCSEAETCH
NIQGSFRCLRFDCPPNYVRVSQTKCERTTCQDITECQTSPARITHYQLNFQTGLLVPAHI
FRIGPAPAFAGDTISLTITKGNEEGYFVTRRLNAYTGVVSLQRSVLEPRDFALDVEMKLW
RQGSVTTFLAKMYIFFTTFAP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fibulin-2 contains a PF01821 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF07645 domain.

Fibulin-2 contains a PF01821 domain.

Fibulin-2 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPSS-IRVT.

Fibulin-2 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPAP-VQAK.

Fibulin-2 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RVSE-MEMA.